The domain within your query sequence starts at position 59 and ends at position 182; the E-value for the PolyA_pol domain shown below is 3.8e-36.

LRIAGGAVRDLLNGVKPQDVDFATTATPTQMKEMFQSAGIRMINNKGEKHGTITARLHEE
NFEVTTLRIDVTTDGRHAEVEFTTDWQKDAERRDLTINSMFLGFDGTLFDYFNGYADLKN
KKVR

PolyA_pol

PolyA_pol
PFAM accession number:PF01743
Interpro abstract (IPR002646):

This group includes nucleic acid independent RNA polymerases, such as polynucleotide adenylyltransferase ( EC 2.7.7.19 ), which adds the poly (A) tail to mRNA. This group also includes the tRNA nucleotidyltransferase that adds the CCA to the 3' of the tRNA ( EC 2.7.7.25 ).

CCA-adding enzymes add the sequence [cytidine(C)-cytidine-adenosine (A)]., one nucleotide at a time, onto the 3' end of tRNA, in a template-independent reaction [ (PUBMED:16171400) (PUBMED:16364630) ]. This Class II group is comprised mainly of eubacterial and eukaryotic enzymes and includes Bacillus stearothermophilus CCAase [ (PUBMED:12526808) ], Escherichia coli poly(A) polymerase I [ (PUBMED:15737627) (PUBMED:10594833) ], human mitochondrial CCAase [ (PUBMED:12729736) (PUBMED:11504732) ], and Saccharomyces cerevisiae CCAase (CCA1) [ (PUBMED:2204621) (PUBMED:1448105) (PUBMED:1634528) ]. CCA-adding enzymes have a single catalytic pocket, which recognizes both ATP and CTP substrates [ (PUBMED:10361280) (PUBMED:10666455) ]. This family belongs to the Pol beta-like NT superfamily [ (PUBMED:10075991) (PUBMED:7482698) ].

Escherichia coli CCAase is related to this group but has not been included in this alignment as this enzyme lacks the N-terminal helix conserved in the remainder of the NT superfamily.

In the Pol beta-like NT superfamily [ (PUBMED:10075991) (PUBMED:7482698) ], the majority of enzymes have two carboxylates, Dx[D/E], together with a third more distal carboxylate, which coordinate two divalent metal cations involved in a two-metal ion mechanism of nucleotide addition. These carboxylate residues are fairly well conserved in this family.

GO process:RNA processing (GO:0006396)
GO function:RNA binding (GO:0003723), nucleotidyltransferase activity (GO:0016779)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry PolyA_pol