The domain within your query sequence starts at position 215 and ends at position 272; the E-value for the PolyA_pol_RNAbd domain shown below is 9.3e-15.
HDHETLEAIAENAKGLAGISGERIWVELKKILTGDHVNHLIHLIYDLGVAPHIGLPAN
PolyA_pol_RNAbd |
---|
PFAM accession number: | PF12627 |
---|---|
Interpro abstract (IPR032828): | This region encompasses much of the RNA and SrmB binding motifs on polymerase A [ (PUBMED:10361280) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry PolyA_pol_RNAbd