The domain within your query sequence starts at position 38 and ends at position 167; the E-value for the Polyketide_cyc domain shown below is 4.7e-25.

VRYSMQEMYDVVSGMEDYQHFVPWCKKSDIISRRSGYCKTRLEVGFPPVLERYTSIVTLV
KPHLVKASCTDGKLFNHLETIWRFSPGLPGYPRTCTLDFSISFEFRSLLHSQLATLFFDE
VVKQMVAAFE

Polyketide_cyc

Polyketide_cyc
PFAM accession number:PF03364
Interpro abstract (IPR005031):

This entry represents the START domain found in polyketide cylcases/dehydrases such as TcmN [(PUBMED:1548230)] and in coenzyme Q-binding protein COQ10 [(PUBMED:19120452)]. COQ10 is required for the function of coenzyme Q in the respiratory chain and has a steroidogenic acute regulatory protein-related lipid transfer (START) domain, known to bind specific lipids in other START domain family members [(PUBMED:23270816), (PUBMED:11276083)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Polyketide_cyc