The domain within your query sequence starts at position 4 and ends at position 193; the E-value for the Polysacc_synt_2 domain shown below is 8.8e-14.

VLVTGGAGYIGSHTVLELLEAGYSPVVIDNFHNAIRGEDSMPESLRRVQELTGRSVEFEE
MDILDQAALQHLFKKHSFKAVIHFAGLKAVGESVQKPLDYYRVNLTGTIQLLEIMRAHGV
KNLVFSSSATVYGNPQYLPLDEAHPTGGCTNPYGKSKFFIEEMIRDLCRADTAWNAVLLR
YFNPIGAHAS

Polysacc_synt_2

Polysacc_synt_2
PFAM accession number:PF02719
Interpro abstract (IPR003869): This domain is found in diverse bacterial polysaccharide biosynthesis proteins including the CapD protein from Staphylococcus aureus [(PUBMED:7961465)], the WalL protein, mannosyl-transferase [(PUBMED:9079898)], and several putative epimerases. The CapD protein is required for biosynthesis of type 1 capsular polysaccharide.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Polysacc_synt_2