The domain within your query sequence starts at position 40 and ends at position 267; the E-value for the Popeye domain shown below is 3e-90.

IHHLVFHVANVCFAVGLLIPTTLHLHMILLRVMLSLGCTLYVVWATLYRCALDVMIWNSV
FLGINILHLSYLLYKKRPVKIEKELGGVYHRLFEPLRVPPDLFRRLTGQFCMIQTLKRGQ
VYATEDKTSVDDRLSILLKGRMKVSYRGHFLHNIYPCAFIDSPEFRSTQMHKGEKFQVTI
VADDNCRFLCWSRERLTYFLESEPFLYEIFRYLIGKDITNKLYSLNDP

Popeye

Popeye
PFAM accession number:PF04831
Interpro abstract (IPR006916):

The Popeye (POP) family of proteins, is mainly restricted to vertebrates and is preferentially expressed in developing and adult striated muscle. It is represented by a conserved region which includes three potential transmembrane domains [(PUBMED:10882522)]. The strong conservation of POP genes during evolution and their preferential expression in heart and skeletal muscle suggest that these novel proteins may have an important function in these tissues in vertebrates.

A number of uncharacterized protein homologues are known from bacteria, invertebrates and apicomplexan protozoa.

GO component:membrane (GO:0016020)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Popeye