The domain within your query sequence starts at position 79 and ends at position 355; the E-value for the Porin_3 domain shown below is 1.5e-81.

NPGTFEECHRKCKELFPVQMEGVKLTVNKGLSNRFQVTHTVALGTIGESNYHFGVTYVGT
KQLSPTEAFPVLVGDMDNSGSLNAQVIHQLSPGLRSKMAIQTQQSKFVNWQVDGEYRGSD
FTAAVTLGNPDVLVGSGILVAHYLQSITPCLALGGELVYHRRPGEEGTVMSLAGKYTLNN
WLATVTLGQAGMHATYYHKASDQLQVGVEFEASTRMQDTSASFGYQLDLPKANFLFKGSV
NSNWIVGATLEKKLPPLPLTLSLCAFLNHRKNKFLCG

Porin_3

Porin_3
PFAM accession number:PF01459
Interpro abstract (IPR027246):

This entry represents both eukaryotic mitochondrial porins and Tom40 proteins.

Eukaryotic mitochondrial porins are voltage-dependent anion-selective channels (VDAC) that behave as general diffusion pores for small hydrophilic molecules [(PUBMED:8031826), (PUBMED:1384178), (PUBMED:1689252), (PUBMED:2442148)]. The channels adopt an open conformation at low or zero membrane potential and a closed conformation at potentials above 30-40 mV. The eukaryotic mitochondrial porins are beta-barrel proteins, composed of between 12 to 16 beta-strands that span the mitochondrial outer membrane. Yeast contains two members of this family (genes POR1 and POR2); vertebrates have at least three members (genes VDAC1, VDAC2 and VDAC3) [(PUBMED:8812436)]. They are related to the mitochondrial import receptor subunit Tom40 proteins, sharing a common evolutionary origin and structure [(PUBMED:22178864)].

Tom40 is a mitochondrion outer membrane protein and a component of the TOM (translocator of the outer mitochondrial membrane) complex, which is essential for import of protein precursors into mitochondria [(PUBMED:10427088)]. In Saccharomyces cerevisiae, TOM complex is composed of the subunits Tom70, Tom40, Tom22, Tom20, Tom7, Tom6, and Tom5 [(PUBMED:1327874), (PUBMED:9774667)]. Tom40 is an integral membrane protein and the main structural component of the protein-conducting channel formed by the TOM complex [(PUBMED:14595396)]. It is stabilised by other components, such as Tom5, Tom6, and Tom7 [(PUBMED:11866524)].

GO process:transmembrane transport (GO:0055085)
GO component:mitochondrial outer membrane (GO:0005741)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Porin_3