The domain within your query sequence starts at position 231 and ends at position 267; the E-value for the Pr_beta_C domain shown below is 3.8e-17.

PTEPVQRAGRYRFAPGTTPVLTREVRPLTLELLEETV

Pr_beta_C

Pr_beta_C
PFAM accession number:PF12465
Interpro abstract (IPR024689):

This domain is found in the C terminus of beta-type subunits of the proteasome, a multimeric complex that degrades proteins into peptides as part of the MHC class I-mediated Ag-presenting pathway [(PUBMED:11035083)]. This domain is approximately 40 amino acids in length. It is found in association with. It contains a conserved GTT sequence motif and a single completely conserved residue Y that may be functionally important.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Pr_beta_C