The domain within your query sequence starts at position 128 and ends at position 501; the E-value for the Prenylcys_lyase domain shown below is 8.1e-157.

FEESSWFVINVIKLVWRYGFQSLRMHMWVEDLLDKFMRIYRYQSHDYAFSSVEKLMHAIG
GDDYVRLLNQTLRENLKKAGFSETFLNEMIAPVMKVNYGQSTDINAFVGAVSLTAADSNL
WAVEGGNKIVCSGLLQASSSNLISGSVMSIEEKTRTKQTGNPTKMYEVVYKTGSETHSDF
YDIVLVAAPLNRKMSNITFRNFDPPIEEFNDPYQQLVTTFIKGELNSTLFSSRPKDQFGL
SAILVTDDSDMFINSLSIVASVRQKEGPPPAVDGMHVWKTFSRDILTKEQISKLFLSYDY
AVRKPWLSYPHYEPPQKCPSIILHDRLYYLNGIEFAASCMEMSAIAGYNAALLAYHRWNG
NEDMIDQDDLYERL

Prenylcys_lyase

Prenylcys_lyase
PFAM accession number:PF07156
Interpro abstract (IPR010795):

This entry represents a conserved region found in a group of prenylcysteine lyases (EC 1.8.3.5) that are approximately 500 residues long. Prenylcysteine lyase is a FAD-dependent thioether oxidase that degrades a variety of prenylcysteines, producing free cysteine, an isoprenoid aldehyde and hydrogen peroxide as products of the reaction [(PUBMED:12186880)]. It has been noted that this enzyme has considerable homology with ClP55, a 55 kDa protein that is associated with chloride ion pumps [(PUBMED:11716481)].

GO process:prenylcysteine catabolic process (GO:0030328), oxidation-reduction process (GO:0055114)
GO function:oxidoreductase activity, acting on a sulfur group of donors, oxygen as acceptor (GO:0016670)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Prenylcys_lyase