The domain within your query sequence starts at position 268 and ends at position 312; the E-value for the Prenyltrans domain shown below is 1.7e-12.
LNLKSLLQWVTSRQMRFEGGFQGRCNKLVDGCYSFWQAGLLPLLH
Prenyltrans |
---|
PFAM accession number: | PF00432 |
---|---|
Interpro abstract (IPR001330): | This repeat is found in a number of proteins, including prenyltransferase subunit beta and geranylgeranyl transferase subunit beta. |
GO function: | catalytic activity (GO:0003824) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Prenyltrans