The domain within your query sequence starts at position 74 and ends at position 117; the E-value for the Prenyltrans domain shown below is 8.4e-12.

MNREEILVFIKSCQHECGGISASIGHDPHLLYTLSAVQILTLYD

Prenyltrans

Prenyltrans
PFAM accession number:PF00432
Interpro abstract (IPR001330):

This repeat is found in a number of proteins, including prenyltransferase subunit beta and geranylgeranyl transferase subunit beta.

GO function:catalytic activity (GO:0003824)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Prenyltrans