The domain within your query sequence starts at position 17 and ends at position 119; the E-value for the Pribosyltran_N domain shown below is 1.7e-36.

LVLSRRLGAELGKSVVYQETNGETRVEIKESVRGQDIFIIQTIPRDVNTAVMELLIMAYA
LKTACARNIIGVIPYFPYSKQSKMRKRGSIVCKLLASMLAKAG

Pribosyltran_N

Pribosyltran_N
PFAM accession number:PF13793
Interpro abstract (IPR029099): This domain is found in N-terminal of ribose-phosphate pyrophosphokinase, frequently N-terminal to IPR000836.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Pribosyltran_N