The domain within your query sequence starts at position 20 and ends at position 138; the E-value for the Pribosyltran_N domain shown below is 3e-41.
LVLFSANSNSSCMELSKKIAERLGVEMGKVQVYQEPNRETRVQIQESVRGKDVFIIQTIS KDVNTTIMELLIMVYACKTSCAKSIIGVIPYFPYSKQCKMRKRGSIVSKLLASMMCKAG
Pribosyltran_N |
---|
PFAM accession number: | PF13793 |
---|---|
Interpro abstract (IPR029099): | This domain is found in N-terminal of ribose-phosphate pyrophosphokinase, frequently N-terminal to IPR000836 . |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Pribosyltran_N