The domain within your query sequence starts at position 38 and ends at position 160; the E-value for the Pribosyltran_N domain shown below is 2.9e-39.
RVFSANSTAACTELAKRITERLGAELGKSVVYQETNGETRVEIKESVRGQDIFIIQTIPS FYCFRDVNTAVMELLIMAYALKTACARNIIGVIPYFPYSKQSKMRKRGSIVCKLLASMLA KAG
Pribosyltran_N |
 |
|---|
| PFAM accession number: | PF13793 |
|---|---|
| Interpro abstract (IPR029099): | This domain is found in N-terminal of ribose-phosphate pyrophosphokinase, frequently N-terminal to IPR000836 . |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Pribosyltran_N