The domain within your query sequence starts at position 1 and ends at position 136; the E-value for the Pro-rich domain shown below is 2.2e-36.
MLVVLLTAALLVLSSAQRQDEEITYEDSNSQLLEMGEQSQGYGHHFPKPPPGGMPPRPPS SDENDDGDEDGSEEDVNRPEEPPQHPPHPGHHHGPPPQGGPQQRPPQPGKQQGPPPQGGP QSPLRPGNQQGPPPQG
Pro-rich |
---|
PFAM accession number: | PF15240 |
---|---|
Interpro abstract (IPR026086): | This family consists of several proline-rich proteins (PRPs). PRPs are tissue-specific expressions of salivary gland multigene families [ (PUBMED:3031057) (PUBMED:2993301) (PUBMED:3521730) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Pro-rich