The domain within your query sequence starts at position 119 and ends at position 578; the E-value for the Pro_dh domain shown below is 7.7e-87.

GEDQESIRPLIRHNKAFGVGFILDYGVEEDLSPEEAERKEMESCTSEAERDGSGANKREK
QYQVHPAFGDRRDGVISARTYFYANEAKCDNYMENLLQCIKASGGASDGGFSAIKLTALG
RPQFLLQFSDVLTRWRRFFHQMAAEQGQAGRAAVDTKLEVAVLQDSIAKMGIASRAEIEG
WFTPETLGVSGTVDLLDWNSLIDSRTRLSRHLVVPNVQTGQLEPLLSRFTEEEEQQMKRM
LQRMDVLAKKAKEAGVRLMIDAEQSYFQPAISRLTLEMQRRFNVDKPFIFNTFQCYLKDA
YDNVTLDMELARREGWCFGAKLVRGAYMAQERVRAAEIGYEDPINPTYEATNAMYHRCLN
YVLEELKHSTKAEVMVASHNEDTVHFTLCRMKEIGLHPADGQVCFGQLLGMCDQISFPLG
QAGFPVYKYVPYGPVMEVLPYLSRRALENSSIMKGAQRER

Pro_dh

Pro_dh
PFAM accession number:PF01619
Interpro abstract (IPR002872): The proline oxidase/dehydrogenase EC 1.5.99.8 is responsible for the first step in the conversion of proline to glutamate for use as a carbon and nitrogen source. The enzyme requires FAD as a cofactor, and is induced by proline.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Pro_dh