The domain within your query sequence starts at position 713 and ends at position 751; the E-value for the Proho_convert domain shown below is 4.3e-26.

LEGSEDSLYSDYVDVFYNTKPYKHRDDRLLQALMDILNE

Proho_convert

Proho_convert
PFAM accession number:PF12177
Interpro abstract (IPR022005):

This domain family is found in eukaryotes, and is approximately 40 amino acids in length. The family is found in association with. There are two completely conserved residues (Y and D) that may be functionally important. This protein is the C-terminal domain of a prohormone convertase enzyme which targets hormones in dense core secretory granules. This C-terminal tail domain is the domain responsible for targeting these dense core secretory granules. The domain adopts an alpha helical structure [(PUBMED:19376969)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Proho_convert