SMART: Pfam domain Proho

The domain within your query sequence starts at position 713 and ends at position 751; the E-value for the Proho_convert domain shown below is 4.3e-26.

LEGSEDSLYSDYVDVFYNTKPYKHRDDRLLQALMDILNE

Proho_convert

PFAM accession number:	PF12177
Interpro abstract (IPR022005):	This domain family is found in eukaryotes, and is approximately 40 amino acids in length. The family is found in association with . There are two completely conserved residues (Y and D) that may be functionally important. This protein is the C-terminal domain of a prohormone convertase enzyme which targets hormones in dense core secretory granules. This C-terminal tail domain is the domain responsible for targeting these dense core secretory granules. The domain adopts an alpha helical structure [ (PUBMED:19376969) ].

PFAM accession number:

PF12177

Interpro abstract (IPR022005):

This domain family is found in eukaryotes, and is approximately 40 amino acids in length. The family is found in association with . There are two completely conserved residues (Y and D) that may be functionally important. This protein is the C-terminal domain of a prohormone convertase enzyme which targets hormones in dense core secretory granules. This C-terminal tail domain is the domain responsible for targeting these dense core secretory granules. The domain adopts an alpha helical structure [ (PUBMED:19376969) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Proho_convert