The domain within your query sequence starts at position 23 and ends at position 67; the E-value for the Prolactin_RP domain shown below is 1.5e-30.
RAHQHSMETRTPDINPAWYTGRGIRPVGRFGRRRAALRDVTGPGL
Prolactin_RP |
 |
|---|
| PFAM accession number: | PF15172 |
|---|---|
| Interpro abstract (IPR026194): | Prolactin-releasing peptide (PrRP) stimulates prolactin (PRL) release and regulates the expression of prolactin through its receptor GPR10. It may stimulate lactotrophs directly to secrete PRL [ (PUBMED:10498338) (PUBMED:9607765) ]. |
| GO function: | hormone activity (GO:0005179) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Prolactin_RP