The domain within your query sequence starts at position 88 and ends at position 145; the E-value for the Prothymosin domain shown below is 1.9e-13.

SWKPAAKGVQDLKEKKEVVEEAENGRDAPANGNAQNEENGEQEADNEVDEEEEEGGEE

Prothymosin

Prothymosin
PFAM accession number:PF03247
Interpro abstract (IPR004931):

Prothymosin alpha and parathymosin are two ubiquitous small acidic nuclear proteins that are thought to be involved in cell cycle progression, proliferation, and cell differentiation [ (PUBMED:10854063) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Prothymosin