The domain within your query sequence starts at position 1 and ends at position 168; the E-value for the Protocadherin domain shown below is 8.9e-68.
RCRQPPHLKASQKNKQNSEWVTPNPENRQMIMMKKKKKKKKKHPPKNLLLNFVTIEEAKP DDGENERNSVTLDLPIELEEQTMGKYNWGTTPTTFKPDSPDLARHYKSASPQPAFQIQPE TPLNSKHHIIQELPLDNTFVGCDSISKCSSSSSDPYSVSECSYPVTTF
Protocadherin |
---|
PFAM accession number: | PF08374 |
---|---|
Interpro abstract (IPR013585): | The structure of protocadherins is similar to that of classic cadherins ( IPR002126 ), but they also have some unique features associated with the cytoplasmic domains. They are expressed in a variety of organisms and are found in high concentrations in the brain where they seem to be localised mainly at cell-cell contact sites. Their expression seems to be developmentally regulated [ (PUBMED:8508762) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Protocadherin