The domain within your query sequence starts at position 189 and ends at position 331; the E-value for the Prp18 domain shown below is 3.1e-66.

TKFLKFLLGVWAKELNAREDYVKRSVQGKLNSATQKQTESYLRPLFRKLRKRNLPADIKE
SITDIIKFMLQREYVKANDAYLQMAIGNAPWPIGVTMVGIHARTGREKIFSKHVAHVLND
ETQRKYIQGLKRLMTICQKHFPT

Prp18

 Prp18
PFAM accession number:PF02840
Interpro abstract (IPR004098):

The splicing factor Prp18 is required for the second step of pre-mRNA splicing. PRP18 appears to be primarily associated with the U5 snRNP.

The structure of a large fragment of the Saccharomyces cerevisiae Prp18 is known [ (PUBMED:10737784) ]. This fragment is fully active in yeast splicing in vitro and includes the sequences of Prp18 that have been evolutionarily conserved. The core structure consists of five alpha-helices that adopt a novel fold. The most highly conserved region of Prp18, a nearly invariant stretch of 19 aa, forms part of a loop between two alpha-helices and may interact with the U5 small nuclear ribonucleoprotein particles [ (PUBMED:10737784) ].

GO process:RNA splicing (GO:0008380)
GO component:spliceosomal complex (GO:0005681)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Prp18