The domain within your query sequence starts at position 1 and ends at position 50; the E-value for the Prp19 domain shown below is 7.9e-23.

MLHSFTLRQQLQTTRQELSHALYQHDAACRVIARLTKEVTAAREALATLK

Prp19

Prp19
PFAM accession number:PF08606
Interpro abstract (IPR013915):

This region is found specifically in PRP19-like protein. The region represented by this protein covers the sequence implicated in self-interaction and a coiled-coiled motif [ (PUBMED:16332694) ]. PRP19-like proteins form an oligomer that is necessary for spliceosome assembly [ (PUBMED:16332694) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Prp19