The domain within your query sequence starts at position 90 and ends at position 183; the E-value for the Pur_ac_phosph_N domain shown below is 2.2e-19.
PEQIHLSYLGEPGTMTVTWTTWAPARSEVQFGSQLSGPLPFRAHGTARAFVDGGVLRRKL YIHRVTLRKLQPGAQYVYRCGSSQGWSRRFRFTA
Pur_ac_phosph_N |
---|
PFAM accession number: | PF16656 |
---|---|
Interpro abstract (IPR015914): | Purple acid phosphatases (PAPs) are ubiquitous binuclear metal-containing acid hydrolases characterised by their acidic pH optima and their intense purple colour due to a TyrO-to-FeIII charge-transfer transition. The amino acid residues coordinating the metal ions are conserved in all PAPs. Active PAPs contain an FeIII ion coordinated to Tyr O, a His N, and an Asp O2, in addition to a divalent metal ion (Fe, Zn, or Mn) coordinated by a His N, a His N, and an Asn O. A hydroxide ion and an Asp O2 bridge the two metal ions [ (PUBMED:12440878) ]. These enzymes share a high degree of homology within their N-termini [ (PUBMED:10510276) ]. |
GO function: | metal ion binding (GO:0046872), acid phosphatase activity (GO:0003993) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Pur_ac_phosph_N