The domain within your query sequence starts at position 3 and ends at position 51; the E-value for the Put_Phosphatase domain shown below is 2.9e-20.

VLLVFDFDNTIIDDNSDTWIVQCAPDKKLPIELQDSYQKGLWTEFMGR

Put_Phosphatase

Put_Phosphatase
PFAM accession number:PF06888
Interpro abstract (IPR016965):

This group represents phosphatases related to PHOSPHO1 and PHOSPHO2 [(PUBMED:14983068)]. It includes plant phosphatases with homology to the haloacid dehalogenase (HAD) superfamily [(PUBMED:21122813), (PUBMED:11161030)]. PHOSPHO1 is a phosphoethanolamine/phosphocholine phosphatase [(PUBMED:15175005)], while PHOSPHO2 has high activity toward pyridoxal 5'-phosphate (PLP), and it is active at much lower level toward pyrophosphate, phosphoethanolamine (PEA)and phosphocholine (PCho) [(PUBMED:16054448)].

GO function:phosphatase activity (GO:0016791)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Put_Phosphatase