The domain within your query sequence starts at position 188 and ends at position 499; the E-value for the Pyr_redox_2 domain shown below is 1.5e-15.

AKIALFGAGPASISCASFLARLGYSNITIFEKQEYVGGLSTSEIPQFRLPYDVVNFEIEL
MKDLGVKIICGKSLSTDEMTLSSLKENGYRAAFIGIGLPEPKKDHIFQGLTQVQGFYTSK
DFLPLVAKSSKTGMCACHSPLPSIRGAVIVLGAGDTAFDCATSALRCGALRVFIVFRKGF
VNIRAVPEEMELAKEEKCEFLPFLSPRKVIVKDGKIVAMQFVRTEQDETGNWVEDEEQTV
RLKADVVISAFGSVLEDPKVKEALSPIKFNRWGLPEVNPETMQTSEPWVFAGGDVVGMAN
TTVESVNDGKQA

Pyr_redox_2

Pyr_redox_2
PFAM accession number:

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Pyr_redox_2