The domain within your query sequence starts at position 3 and ends at position 228; the E-value for the Pyr_redox_2 domain shown below is 3.8e-13.

KRVAIVGAGVSGLASIKCCLEEGLEPTCFERSSDLGGLWRFTEHVEEGRASLYKSVVSNS
SREMSCYPDFPFPEDYPNFVPNSLFLEYLKLYSTQFNLQRCIYFNTKVCSITKRPDFAVS
GQWEVVTVTNGKQNSAIFDAVMVCTGFLTNPHLPLDSFPGILTFKGEYFHSRQYKHPDIF
KDKRVLVVGMGNSGTDIAVEASHLAKKVFLSTTGGAWVISRVFDSG

Pyr_redox_2

Pyr_redox_2
PFAM accession number:

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Pyr_redox_2