The domain within your query sequence starts at position 4 and ends at position 208; the E-value for the Pyr_redox_2 domain shown below is 8.2e-9.

RVAIVGAGVSGLASIKCCLEEGLEPTCFERSSDLGGLWRFTEHVEEGRASLYKSVVSNSS
REMSCYPDFPFPEDYPNFVPNSLFLEYLKLYSTQFNLQRCIYFNTKVCSITKRPDFAVSG
QWEVVTVTNGKQNSAIFDAVMVCTGFLTNPHLPLDSFPGILTFKGEYFHSRQYKHPDIFK
DKRVLVVGMGNSGTDIAVEASHLAK

Pyr_redox_2

Pyr_redox_2
PFAM accession number:

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Pyr_redox_2