The domain within your query sequence starts at position 389 and ends at position 498; the E-value for the Pyr_redox_dim domain shown below is 1.6e-43.

VPSVIYTHPEVAWVGKSEEQLKEEGIEFKIGKFPFAANSRAKTNADTDGMVKILGHKSTD
RVLGAHILGPGAGEMVNEAALALEYGASCEDIARVCHAHPTLSEAFREAN

Pyr_redox_dim

Pyr_redox_dim
PFAM accession number:PF02852
Interpro abstract (IPR004099):

This entry represents a dimerisation domain that is usually found at the C-terminal of both class I and class II oxidoreductases, as well as in NADH oxidases and peroxidases [(PUBMED:7766608), (PUBMED:11090282), (PUBMED:12390015)].

GO process:oxidation-reduction process (GO:0055114), cell redox homeostasis (GO:0045454)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Pyr_redox_dim