The domain within your query sequence starts at position 395 and ends at position 508; the E-value for the Pyr_redox_dim domain shown below is 1.2e-30.
VPTTVFTPLEYGCVGLSEEEAVALHGQEHVEVYHAYYKPLEFTVADRDASQCYIKMVCMR EPPQLVLGLHFLGPNAGEVTQGFALGIKCGASYAQVMQTVGIHPTCSEEVVKLH
Pyr_redox_dim |
![]() |
---|
PFAM accession number: | PF02852 |
---|---|
Interpro abstract (IPR004099): | This entry represents a dimerisation domain that is usually found at the C-terminal of both class I and class II oxidoreductases, as well as in NADH oxidases and peroxidases [ (PUBMED:7766608) (PUBMED:11090282) (PUBMED:12390015) ]. |
GO process: | oxidation-reduction process (GO:0055114), cell redox homeostasis (GO:0045454) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Pyr_redox_dim