The domain within your query sequence starts at position 114 and ends at position 284; the E-value for the QRPTase_C domain shown below is 1.3e-61.
IASAAATAVEVARSTGWTGHVAGTRKTTPGFRLVEKYGLQVGGAACHRYDLGGMVMVKDN HVVAAGSMERAVLKARQAAGFSLKVEVECSSLEEAFRAAEAGADLVMLDNFKPEELHPTA ATLKARFPSVSVEASGGVTLDNLTQFCGTHIDVISLGMLTQAAPALDFSLK
QRPTase_C |
 |
|---|
| PFAM accession number: | PF01729 |
|---|---|
| Interpro abstract (IPR002638): | Quinolinate phosphoribosyl transferase (QPRTase) or nicotinate-nucleotide pyrophosphorylase EC 2.4.2.19 is involved in the de novo synthesis of NAD in both prokaryotes and eukaryotes. It catalyses the reaction of quinolinic acid with 5-phosphoribosyl-1-pyrophosphate (PRPP) in the presence of Mg 2+ to give rise to nicotinic acid mononucleotide (NaMN), pyrophosphate and carbon dioxide [ (PUBMED:9016724) (PUBMED:8561507) ]. Unlike IPR004393 this domain also includes the molybdenum transport system protein ModD. |
| GO process: | NAD biosynthetic process (GO:0009435) |
| GO function: | nicotinate-nucleotide diphosphorylase (carboxylating) activity (GO:0004514) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry QRPTase_C