The domain within your query sequence starts at position 27 and ends at position 112; the E-value for the QRPTase_N domain shown below is 5.5e-24.
CPGLNFASLVTGSAPSQAVLWAKSPGVLAGRPFFDAIFTQLNCQVSWFLPEGSKLVPVVK VAEVKGPAHHLLLGERVALNTLARCS
QRPTase_N |
 |
|---|
| PFAM accession number: | PF02749 |
|---|---|
| Interpro abstract (IPR022412): | Quinolinate phosphoribosyl transferase (QPRTase) or nicotinate-nucleotide pyrophosphorylase EC 2.4.2.19 is involved in the de novo synthesis of NAD in both prokaryotes and eukaryotes. It catalyses the reaction of quinolinic acid with 5-phosphoribosyl-1-pyrophosphate (PRPP) in the presence of Mg 2+ to give rise to nicotinic acid mononucleotide (NaMN), pyrophosphate and carbon dioxide [ (PUBMED:9016724) (PUBMED:8561507) ]. Unlike IPR004393 this domain also includes the molybdenum transport system protein ModD. |
| GO function: | transferase activity, transferring pentosyl groups (GO:0016763) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry QRPTase_N