The domain within your query sequence starts at position 312 and ends at position 341; the E-value for the Quaking_NLS domain shown below is 5.5e-24.

GAVATKVRRHDMRVHPYQRIVTADRAATGN

Quaking_NLS

 Quaking_NLS
PFAM accession number:PF16551
Interpro abstract (IPR032367):

This entry represents the very C-terminal region of quaking proteins that is purported to be the nuclear localisation signal [ (PUBMED:8589716) (PUBMED:21447554) ]. Quaking is a RNA-binding protein that plays a central role in myelinisation [ (PUBMED:10864952) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Quaking_NLS