The domain within your query sequence starts at position 767 and ends at position 1366; the E-value for the RAB3GAP2_C domain shown below is 3.2e-245.

QLLSLLLSVWLSKEKDILDKPQSVCCLHTMLSLLSKMKVAIDETWDSQSVSPWWQQMRMA
CIQSENSGAALLSAHVGHSVAAQMSSGATDKKFSQMVLDADAEALTDSWEALSLDTEYWK
LLLRQLEDCLILQTLLHSKLSPPAAKAPSLQSEPLPRLSVKKLLEGGKGGIADSVAKWIF
KQDLSPELLKCANKERDVENPDEPREGITRSFPEVSEVEIDLGAVPDLLHLAYEQFPCSL
ELDVLHAHCCWEYVVQWNKDPEEARFLVRSIEHLKHILNPHVQNGIALMMWNTFLVKRFS
AATYLMDKVGKSPKDRLCRRDVGMSDTALTSFLGSCLELLQTSLEADISRDEVQVPVLDT
EDAWLSVEGPISIVELALEQKPIHYPLVEHHSVLCSILYASMRFSLKSVKPLALFDSKGK
NAFFKDLTSIQLLPSGEMDPNFISVRQQFLLKVVSAAVQAQHSKDKDPSAEAANTHWKDL
NWPGLAVDLAHHLQVSDDVIRRHYVGELYSHGADLLGEEAIFQVQDKEVLASQLLVLTGQ
RLAHALFHTQTKEGMELLARLPPTLCTWLKAMNPQDLQNTGVPIAATAKLVHKVMELLPE

RAB3GAP2_C

RAB3GAP2_C
PFAM accession number:PF14656
Interpro abstract (IPR029257):

This entry represents the C terminus of the Rab3 GTPase-activating protein non-catalytic subunit. Rab3 GTPase-activating complex specifically converts active Rab3-GTP to the inactive form Rab3-GDP [(PUBMED:9733780)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry RAB3GAP2_C