The domain within your query sequence starts at position 73 and ends at position 497; the E-value for the RAB3GAP2_N domain shown below is 1.3e-157.

WLQECVLSLSPTSDLMVIAREQKAAFLVPKWKHGDKGKEEMQFAVGWSGSVSAEEGEYVT
SALCIPLASQKRSSTGRPDWTCIVVGFTSGYVRFYTESGVLLLAQLLNEDKVLQLKCRTY
EIPRHPGVTEQNEELSILYPAAIVTIDGFSLFQSLRACRNQVAKAAASGNENIQPPPLAY
KKWGLQDIDTIIDHASIGIMTLSPFDQMKTASNIGGFNAAIKNSPPAMSQYITVGSSPFT
GFFYALEGSTQPLLSHVALAVASKLTSALFSAASGWLGWKSKHEEDTVQKQKPKMEPATP
LAVRFGLPDSRRHGESICLSPCNTLAAVTDDFGRVILLDVARGIAIRMWKGYRDAQVGWI
QIVEDLHERVPEKGGFSPFGNTQGPSRVAQFLVIYAPRRGILEVWNTQQGPRVGAFNVGK
HCRLL

RAB3GAP2_N

RAB3GAP2_N
PFAM accession number:PF14655
Interpro abstract (IPR032839):

This family includes the N terminus of the Rab3 GTPase-activating protein (GAP) non-catalytic subunit. Rab3 GTPase-activating protein is a GTPase activating protein with specificity for Rab3 subfamily [(PUBMED:9733780)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry RAB3GAP2_N