The domain within your query sequence starts at position 339 and ends at position 430; the E-value for the RAC_head domain shown below is 2.8e-24.
KKEKDIQKKAIKKERQKLRNSCKSWNHFSDNEADRVKMMEEVEKLCDRLELASLQGLNEI LASSTREVGKAALEKQIEEVNEQMRREKEEAD
RAC_head |
 |
|---|
| PFAM accession number: | PF16717 |
|---|---|
| Interpro abstract (IPR032003): | The ribosome-associated complex (RAC) head domain is involved in ribosome binding [ (PUBMED:23202586) ]. It can be found at the C terminus of the yeast Zuotin (Zuo1) protein. Zuo1 is a component of RAC, a stable ribosome-associated heterodimer that functions as a chaperone at the ribosome [ (PUBMED:20368619) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry RAC_head