The domain within your query sequence starts at position 937 and ends at position 975; the E-value for the RAD51_interact domain shown below is 1.3e-20.

GGSHFSHGISRVQPLKTCSRPIRVGLSRRARLKQLHPYL

RAD51_interact

RAD51_interact
PFAM accession number:PF15696
Interpro abstract (IPR031419):

This motif interacts with RAD51, a protein that plays an important role in mitotic and meiotic recombination, and in DNA repair [(PUBMED:16990250)]. This motif is found C-terminal in RAD51-associated protein 1 (RAD51AP1) and 2 (RAD51AP2).

This is a PFAM domain. For full annotation and more information, please see the PFAM entry RAD51_interact