The domain within your query sequence starts at position 414 and ends at position 491; the E-value for the RAG2_PHD domain shown below is 7.2e-50.
GYWITCCPTCDVDINTWVPFYSTELNKPAMIYCSHGDGHWVHAQCMDLEERTLIHLSEGS NKYYCNEHVQIARALQTP
RAG2_PHD |
---|
PFAM accession number: | PF13341 |
---|---|
Interpro abstract (IPR025162): | This domain, a non-canonical plant homeodomain (PHD) finger, is found at the C terminus of the Recombination activating gene 2 (RAG2) protein. The PHD finger is a chromatin-binding module that has been shown bound to histone H3 trimethylated at lysine 4 (H3K4me3) and influences V(D)J recombination [ (PUBMED:18033247) ]. RAG-2 is an essential component of the lymphoid-specific recombination activating gene RAG1/2 V(D)J recombinase mediating antigen-receptor gene assembly. It contains an acidic hinge region implicated in histone-binding, a non-canonical plant homeodomain (PHD) finger followed by a C-terminal extension of 40 amino acids that is essential for phosphoinositide (PtdIns)-binding. [ (PUBMED:18033247) (PUBMED:15964836) (PUBMED:18025461) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry RAG2_PHD