The domain within your query sequence starts at position 15 and ends at position 65; the E-value for the RAI1 domain shown below is 1.3e-15.

VDCLNPQAPCTQPPSCYVELKTSKEMHSPGQWRSFYRHKLLKWWAQFRLFL

RAI1

RAI1
PFAM accession number:PF08652
Interpro abstract (IPR013961):

RAI1 is homologous to Caenorhabditis elegans DOM-3 and human DOM3Z and binds to a nuclear exoribonuclease [(PUBMED:10805743)]. It is required for 5.8S rRNA processing [(PUBMED:10805743)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry RAI1