SMART: Pfam domain RAI1

The domain within your query sequence starts at position 235 and ends at position 303; the E-value for the RAI1 domain shown below is 4.2e-29.

VDCLNPQAPCTQPPSCYVELKTSKEMHSPGQWRSFYRHKLLKWWAQSFLPGVPHVVAGFR
NPEGFVCSL

RAI1

PFAM accession number:	PF08652
Interpro abstract (IPR013961):	Yeast RAI1 is homologous to Caenorhabditis elegans DOM-3 and human DOM3Z (DXO). They have both decapping and 5'-3' exoribonuclease activity and are a component of the mRNA 5'-end capping quality control mechanism [ (PUBMED:22961381) (PUBMED:26101253) ]. RAI1 is a single-copy gene in most organisms; however S. cerevisiae contains a second homologue, DXO1, which also possesses decapping and 5'-3' exoribonuclease activity, whereas RAI1 has decapping and pyrophosphohydrolase activities [ (PUBMED:22961381) ].

PFAM accession number:

PF08652

Interpro abstract (IPR013961):

Yeast RAI1 is homologous to Caenorhabditis elegans DOM-3 and human DOM3Z (DXO). They have both decapping and 5'-3' exoribonuclease activity and are a component of the mRNA 5'-end capping quality control mechanism [ (PUBMED:22961381) (PUBMED:26101253) ]. RAI1 is a single-copy gene in most organisms; however S. cerevisiae contains a second homologue, DXO1, which also possesses decapping and 5'-3' exoribonuclease activity, whereas RAI1 has decapping and pyrophosphohydrolase activities [ (PUBMED:22961381) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry RAI1