The domain within your query sequence starts at position 96 and ends at position 259; the E-value for the RAI16-like domain shown below is 7.2e-42.
LLEFALREDLLSRVLTWQLQWDEFGDGVEERRAEQLKLFEMLVSEARQPLLRHGPVREAL LALLDACGRPVPSSPALDEGLVLLLSQLCVCVAREPSLLEFFLQPPPEPGAAPRLLLFSR LVPFVHREGTLGQQARDALLLLMALSDGSPTVGRYIADHSYFCP
RAI16-like |
---|
PFAM accession number: | PF10257 |
---|---|
Interpro abstract (IPR019384): | This entry represents a conserved sequence region found in a family of proteins described as retinoic acid-induced protein 16-like proteins. These proteins are conserved from worms to humans, but their function is not known. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry RAI16-like