The domain within your query sequence starts at position 9 and ends at position 89; the E-value for the RAM domain shown below is 1.5e-31.
PNFEDMFASRFTKDGKEYQEYLKRPPESPPIVEEWNSRAGGNQRNRGNWLQDNRQFRGRD NRQGWPTDNRSNQWHGWTWGN
RAM |
---|
PFAM accession number: | PF15320 |
---|---|
Interpro abstract (IPR028271): | This entry represents RNA guanine-N7 methyltransferase activating subunit (RAMAC; also known as RNMT-activating mini protein, RAM), which is an essential component of the mRNA-capping methyltransferase RNMT:RAMAC complex required for mRNA cap methylation [ (PUBMED:22099306) (PUBMED:27422871) ]. RAM consists of an N-terminal RNMT-activating domain and a C-terminal RNA-binding domain [ (PUBMED:22099306) ]. In eukaryotes, the 7-methylguanosine cap added to the 5' end of mRNA is required for efficient gene expression. In mammals, methylation of the guanosine cap requires RNMT (RNA guanine-7 methyltransferase) [ (PUBMED:22099306) ]. The interaction between RNMT and RAM enhances the mRNA binding capacity and cap methyltransferase activity [ (PUBMED:22099306) ]. |
GO process: | RNA 5'-cap (guanine-N7)-methylation (GO:0106005) |
GO component: | mRNA cap binding complex (GO:0005845) |
GO function: | RNA binding (GO:0003723) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry RAM