The domain within your query sequence starts at position 37 and ends at position 146; the E-value for the RAMP domain shown below is 1.1e-49.
QELCLSRFKENMETIGKTLWCDWGKTIQSYGELTYCTKHVAHTIGCFWPNPEVDRFFIAV HHRYFSKCPISGRALRDPPNSILCPFIALPITVTLLMTALVVWRSKRTEG
RAMP |
---|
PFAM accession number: | PF04901 |
---|---|
Interpro abstract (IPR006985): | The calcitonin-receptor-like receptor can function as either a calcitonin-gene-related peptide or an adrenomedullin receptor. The receptors function is modified by receptor activity modifying protein (RAMP). RAMPs are single-transmembrane-domain proteins [ (PUBMED:9620797) ]. |
GO process: | regulation of G protein-coupled receptor signaling pathway (GO:0008277), intracellular protein transport (GO:0006886) |
GO component: | integral component of membrane (GO:0016021) |
GO function: | coreceptor activity (GO:0015026) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry RAMP