The domain within your query sequence starts at position 29 and ends at position 140; the E-value for the RAMP domain shown below is 1.5e-43.

ETHVLPCWYEYKSCMDSVKDWCNWTLISRHYSDLQNCLEYNADKFGLGFPNPLAENIILE
AHLIHFANCSLVQPTFSDPPEDVLLAMIIAPICLIPFLVTLVVWRSKDSDAQ

RAMP

RAMP
PFAM accession number:PF04901
Interpro abstract (IPR006985):

The calcitonin-receptor-like receptor can function as either a calcitonin-gene-related peptide or an adrenomedullin receptor. The receptors function is modified by receptor activity modifying protein (RAMP). RAMPs are single-transmembrane-domain proteins [(PUBMED:9620797)].

GO process:regulation of G-protein coupled receptor protein signaling pathway (GO:0008277), intracellular protein transport (GO:0006886)
GO component:integral component of membrane (GO:0016021)
GO function:protein transporter activity (GO:0008565)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry RAMP