The domain within your query sequence starts at position 166 and ends at position 264; the E-value for the RBB1NT domain shown below is 1.8e-46.

RKQTDELLGKVVCVDYVSLEKKKAMWFPALVVCPDCSDEIAVKKDNILVRSFKDGKFTSV
PRKDVHEITSDTVPKPDAVLKQAFDQALEFHKSRAIPAN

RBB1NT

RBB1NT
PFAM accession number:PF08169
Interpro abstract (IPR012603):

This domain is found N-terminal to the ARID/BRIGHT domain in DNA-binding proteins of the Retinoblastoma-binding protein 1 family [(PUBMED:15112237)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry RBB1NT