The domain within your query sequence starts at position 230 and ends at position 329; the E-value for the RCSD domain shown below is 1.3e-9.
GTPWSAEKPRRRNTCNSTEKPEELVRTPEEANAGEKVGQNPDTASQGHPEVQAPSQTGSP EAENGCGSPREETTPGEHTDTGKATEGTASEERVADEDRL
RCSD |
---|
PFAM accession number: | PF05177 |
---|---|
Interpro abstract (IPR007850): | Proteins containing this region include Caenorhabditis elegans, UNC-89. This region is found repeated in UNC-89 and shows conservation in prolines, lysines and glutamic acids. Proteins with RCSD are involved in muscle M-line assembly, but the function of this region RCSD is not clear. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry RCSD