The domain within your query sequence starts at position 120 and ends at position 248; the E-value for the RD3 domain shown below is 3.3e-48.

PWLRWNDTPPRLSARTPAEMVLETLMMELAGQMREVERQQRERRSAVRKICTGVDYSWLA
NTPRPTYDISPGERLQLEDVCAKIHPSYCGPAILRFRQLLAEREPEVQEVARLFRSVLQE
ALEKMKQEE

RD3

RD3
PFAM accession number:PF14473
Interpro abstract (IPR028092):

In humans, Retinal degeneration protein 3 (RD3) is found preferentially expressed in the retina [(PUBMED:12914764)]. Mutations in RD3 causes Leber Congenital Amaurosis type 12,which is a severe dystrophy of the retina, typically becoming evident in the first years of life [(PUBMED:17186464)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry RD3