SMART: Pfam domain RED

The domain within your query sequence starts at position 76 and ends at position 302; the E-value for the RED_N domain shown below is 1.6e-105.

KKKSYYAKLRQQEIERERELAEKYRDRAKERRDGVNKDYEETELISTTANYRAVGPTAEA
DKSAAEKRRQLIQESKFLGGDMEHTHLVKGLDFALLQKVRAEIASKEKEEEELMEKPQKE
TKKDEDPENKIEFKTRLGRNVYRMLFKSKSYERNELFLPGRMAYVVDLDDEYADTDIPTT
LIRSKADCPTMEAQTTLTTNDIVISKLTQILSYLRQGTRNKKLKKKD

RED_N

PFAM accession number:	PF07808
Interpro abstract (IPR012916):	This domain contains sequences that are similar to the N-terminal region of Red protein ( Q13123 ). This and related proteins contain a RED repeat which consists of a number of RE and RD sequence elements [ (PUBMED:10216252) ]. The region in question has several conserved NLS sequences and a putative trimeric coiled-coil region [ (PUBMED:10216252) ], suggesting that these proteins are expressed in the nucleus [ (PUBMED:10216252) ]. Protein RED (also known as IK) is found in the nucleus and is a component of the spliceosome [ (PUBMED:28781166) ]. It is also associated with the spindle pole where it co-localizes with and interacts with the spindle assembly checkpoint protein MAD1 during metaphase and anaphase. Depletion of RED shortens the mitotic cycle and MAD1 is incorrectly localized [ (PUBMED:22351768) ].

PFAM accession number:

PF07808

Interpro abstract (IPR012916):

This domain contains sequences that are similar to the N-terminal region of Red protein ( Q13123 ). This and related proteins contain a RED repeat which consists of a number of RE and RD sequence elements [ (PUBMED:10216252) ]. The region in question has several conserved NLS sequences and a putative trimeric coiled-coil region [ (PUBMED:10216252) ], suggesting that these proteins are expressed in the nucleus [ (PUBMED:10216252) ]. Protein RED (also known as IK) is found in the nucleus and is a component of the spliceosome [ (PUBMED:28781166) ]. It is also associated with the spindle pole where it co-localizes with and interacts with the spindle assembly checkpoint protein MAD1 during metaphase and anaphase. Depletion of RED shortens the mitotic cycle and MAD1 is incorrectly localized [ (PUBMED:22351768) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry RED_N