SMART: Pfam domain REJ

The domain within your query sequence starts at position 130 and ends at position 598; the E-value for the REJ domain shown below is 6.2e-116.

ITVRWYCPDALVIRKSWVYFSVASVNDTPDWNRPVLLPQVAVSKGFSLHIPKYALPYGVY
VFNFTLSIFRWDLAWPTVTGSDIIYIWVRKRPLKAVLLGAPRVTVKFSDELILNGSMSYD
PEADIPTWGLQFFWYCTTNPRYYSGNYVLVINQAVCHPEQDSLNWPWAVGSVLTIPPKTL
RGNGVYYFRMVVQKQNRTAFSDKTVHVLQGLQPKAHISCIENCGPTLGVSDRFSLFLNCP
SCGRQDLYSWSILSLTGHEVMFDWAGQAITRRNGPYLSIKAFAFRNFLENRVWVSLILKS
WSGMTTTLRHPVVINHGPRVGKCKINPASGISMVTKFAVECSDFKDENLPLKYKIIVSEL
DSIGAISSVEENTLGSVVYSGAEPITPAFFLPVGTVTDEYNVRLYVQVYDSLGTFSQVTL
QATVTAPTVRDSSKDVLQQLLNVTMKPTSLLSTLLQKQDWLQAGYLTYV

REJ

PFAM accession number:	PF02010
Interpro abstract (IPR002859):	The REJ (Receptor for Egg Jelly) domain is found in PKD1 P98161 and the sperm receptor for egg jelly Q26627 . The exact function of this domain is unknown. The domain is 600 amino acids long so is probably composed of multiple structural domains. There are six completely conserved cysteine residues that may form disulphide bridges. This region contains tandem PKD-like domains. Sequence similarity between a region of the autosomal dominant polycystic kidney disease (ADPKD) protein, polycystin-1 and a sea urchin sperm glycoprotein involved in fertilization, the receptor for egg jelly (suREJ) has been known for some time. The suREJ protein binds the glycoprotein coat of the egg (egg jelly), triggering the acrosome reaction, which transforms the sperm into a fusogenic cell. The sequence similarity and expression pattern suggests that the predicted human PKDREJ protein is a mammalian equivalent of the suREJ protein and therefore may have a central role in human fertilization [ (PUBMED:9949214) ].

PFAM accession number:

PF02010

Interpro abstract (IPR002859):

The REJ (Receptor for Egg Jelly) domain is found in PKD1 P98161 and the sperm receptor for egg jelly Q26627 . The exact function of this domain is unknown. The domain is 600 amino acids long so is probably composed of multiple structural domains. There are six completely conserved cysteine residues that may form disulphide bridges. This region contains tandem PKD-like domains.

Sequence similarity between a region of the autosomal dominant polycystic kidney disease (ADPKD) protein, polycystin-1 and a sea urchin sperm glycoprotein involved in fertilization, the receptor for egg jelly (suREJ) has been known for some time. The suREJ protein binds the glycoprotein coat of the egg (egg jelly), triggering the acrosome reaction, which transforms the sperm into a fusogenic cell. The sequence similarity and expression pattern suggests that the predicted human PKDREJ protein is a mammalian equivalent of the suREJ protein and therefore may have a central role in human fertilization [ (PUBMED:9949214) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry REJ