The domain within your query sequence starts at position 335 and ends at position 432; the E-value for the REPA_OB_2 domain shown below is 5e-37.
IGDLESKAKDALVDIIGICKSYEDSIKITVKSNNREVAKRNIYLMDMSGKVVTTTLWGED ADKFDGSRQPVMAIKGARVSDFGGRSLSVLSSSTVIVN
REPA_OB_2 |
 |
|---|
| PFAM accession number: | PF16900 |
|---|---|
| Interpro abstract (IPR031657): | Replication protein A contains two OB domains in it's DNA binding region. This is the second of the OB domains [ (PUBMED:8990123) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry REPA_OB_2