The domain within your query sequence starts at position 335 and ends at position 432; the E-value for the REPA_OB_2 domain shown below is 5e-37.

IGDLESKAKDALVDIIGICKSYEDSIKITVKSNNREVAKRNIYLMDMSGKVVTTTLWGED
ADKFDGSRQPVMAIKGARVSDFGGRSLSVLSSSTVIVN

REPA_OB_2

REPA_OB_2
PFAM accession number:PF16900
Interpro abstract (IPR031657):

Replication protein A contains two OB domains in it's DNA binding region. This is the second of the OB domains [(PUBMED:8990123)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry REPA_OB_2