The domain within your query sequence starts at position 290 and ends at position 400; the E-value for the RF-1 domain shown below is 2.6e-41.

DEVDVKVDPKDLRVDTFRARGAGGQHVNTTDSAVRLVHIPTGLVVECQQERSQLKNKEIA
LRVLRARLYQQIIEKDRCQQQNARKLQVGTRAQSERIRTYNFTQDRVTDHR

RF-1

RF-1
PFAM accession number:PF00472
Interpro abstract (IPR000352): Peptide chain release factors (RFs) are required for the termination of protein biosynthesis [(PUBMED:8821264)]. At present two classes of RFs can be distinguished. Class I RFs bind to ribosomes that have encountered a stop codon at their decoding site and induce release of the nascent polypeptide. Class II RFs are GTP-binding proteins that interact with class I RFs and enhance class I RF activity. In prokaryotes there are two class I RFs that act in a codon specific manner [(PUBMED:2215213)]: RF-1 (gene prfA) mediates UAA and UAG-dependent termination while RF-2 (gene prfB) mediates UAA and UGA-dependent termination. RF-1 and RF-2 are structurally and evolutionary related proteins which have been shown to be part of a larger family [(PUBMED:1408743)].
GO process:translational termination (GO:0006415)
GO function:translation release factor activity (GO:0003747)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry RF-1