The domain within your query sequence starts at position 899 and ends at position 1052; the E-value for the RFC1 domain shown below is 2.5e-61.

ICDGDLVDNQIRSKQNWSLLPTQAIYASVLPGELMRGYMTQFPSFPSWLGKHSSTGKHDR
IVQDLSLHMSLRTYSSKRTVNMDYLSHIRDALVRPLTSQGVEGAQHVIKLMDTYYLMKED
FENIMEVSSWGGKPSAFSKLDPKVKAAFTRAYNK

RFC1

RFC1
PFAM accession number:PF08519
Interpro abstract (IPR013725):

This is the C-terminal domain of replication factor C, RFC1. RFC complexes hydrolyse ATP and load sliding clamps such as PCNA (proliferating cell nuclear antigen) onto double-stranded DNA. RFC1 is essential for RFC function in vivo [(PUBMED:16040599), (PUBMED:9092549)].

GO process:DNA replication (GO:0006260)
GO component:DNA replication factor C complex (GO:0005663)
GO function:DNA clamp loader activity (GO:0003689), ATP binding (GO:0005524)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry RFC1